Protein Info for GFF6742 in Variovorax sp. SCN45

Annotation: NAD(P)H-flavin oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01613: Flavin_Reduct" amino acids 21 to 160 (140 residues), 78.7 bits, see alignment E=2.6e-26

Best Hits

Swiss-Prot: 48% identical to YDDH_ECOLI: Uncharacterized protein YddH (yddH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_1222)

Predicted SEED Role

"NAD(P)H-flavin oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>GFF6742 NAD(P)H-flavin oxidoreductase (Variovorax sp. SCN45)
MNASHRLSVPLDKAYRLLNHGPTVLVSAAHGGQRNIMAAAWAMPLDFAPPKVAVVLDKST
WTRVLLEGAGSFALQVPTRAQLDLTEALGNSSGREIVEQSGHDKFAAYGLQTFAGTATDA
PLLEGCAAWLECRLLPEPHIQQSYDLFLGEVIAAQADSRVFANGRWNFDGHDELRTLHHV
AGGHFIVDGEAVDARPLPPVRS