Protein Info for GFF674 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Dethiobiotin synthetase (EC 6.3.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF13500: AAA_26" amino acids 3 to 207 (205 residues), 144.5 bits, see alignment E=3.7e-46 PF01656: CbiA" amino acids 6 to 206 (201 residues), 56.2 bits, see alignment E=3.5e-19 TIGR00347: dethiobiotin synthase" amino acids 6 to 176 (171 residues), 205.8 bits, see alignment E=2.4e-65

Best Hits

Swiss-Prot: 100% identical to BIOD1_SALTY: ATP-dependent dethiobiotin synthetase BioD 1 (bioD1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 99% identity to sek:SSPA1823)

MetaCyc: 75% identical to dethiobiotin synthetase (Escherichia coli K-12 substr. MG1655)
Dethiobiotin synthase. [EC: 6.3.3.3]

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.3.3

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF674 Dethiobiotin synthetase (EC 6.3.3.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VTKRYFVTGTDTEVGKTVASCALLQAATQLGYQTVGYKPVASGSEMTTDGLRNSDALALQ
RNSSLPQPYSAINPYTFAEPTSPHIVSADEGRAIDAAVLSRGLRTLEAQADWVLTEGAGG
WFTPLSATLTFADWVQTEQLPVILVVGVKLGCINHAMLTALAVEQAGLPLVGWIANDIQP
PGARHGEYLATLRRVIPAPLLGEIPWLGVSPSQAATGQYLDLSPLERA