Protein Info for GFF6732 in Variovorax sp. SCN45

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 229 to 256 (28 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 281 (272 residues), 141.3 bits, see alignment E=1.7e-45

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 40% identity to ctt:CtCNB1_1146)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF6732 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Variovorax sp. SCN45)
VSLTGWAELLAGGLITGGIYALVAIGLNLQYGLMRIMNISHGEFLMLGAFATWWAHTALG
ISPLLFMPVAFALLMALGMTVHWLCFRQVAARAPNVDVFEARSLMVGFGLMFLVQNTALL
VWGGDLRGYDYLADPVQVGEMRFTANKLVLFGVALALSLLLIALLKLTLLGKAVRALMQS
PTGAQLVGINTKRLHPLMFGIGLGLSGVAGALLSMTYEISPSMGEPYTVTALIVITLGGF
GSIAGSLVGGLLLGVVEALGMYYTSPSLKMLLSYAVFIGVLIWRPNGLFSRK