Protein Info for GFF6731 in Variovorax sp. SCN45

Annotation: Nucleoside ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 237 to 263 (27 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 37 to 286 (250 residues), 109.8 bits, see alignment E=6.8e-36

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 40% identity to ctt:CtCNB1_1145)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF6731 Nucleoside ABC transporter, permease protein 1 (Variovorax sp. SCN45)
MILSLPRNKPWLVLCIGLVLAAAVPWVASEFVASVALGCLMYIALATSWSLFCGATRYLS
LATSAFFGLGAYASATLLDVLPWPLVILSGAAIASAVAVLMGAAVLHLRGTYFAVLTFGM
TELIRHAVTFVEKQVSGTVGRVLTVVPSNETVYLTVLAIAGAAIATALLVKRSRFGLALA
GIGADEQRAQTLGVDTRRAKVMGFALTAAFAGAVGAAMAVRWTYIDPPAVFSPFIGFQTV
LIAMIGGATSIGGPVAAAIVFSLLSETLRLQLPYGYMMVLGLLLILCVMYLPNGLASLWQ
RKAAALRRHGHG