Protein Info for GFF673 in Xanthobacter sp. DMC5

Annotation: Maltose regulon regulatory protein MalI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF00356: LacI" amino acids 38 to 81 (44 residues), 57.3 bits, see alignment 2.2e-19 PF00532: Peripla_BP_1" amino acids 94 to 357 (264 residues), 92.2 bits, see alignment E=8.6e-30 PF13407: Peripla_BP_4" amino acids 97 to 339 (243 residues), 61.9 bits, see alignment E=1.5e-20 PF13377: Peripla_BP_3" amino acids 203 to 363 (161 residues), 127.8 bits, see alignment E=9.1e-41

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 77% identity to azc:AZC_4404)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>GFF673 Maltose regulon regulatory protein MalI (Xanthobacter sp. DMC5)
VEGAKGPQGRRLPAARDAAEPADLPDEAPLAGGLRVRLKDVAAHAGVSRATVSLVLRKSP
LVKAETRAKVEEAMAGLGYVYNRSAANLRSGASRTVGLVLCEITTPNFAQLTAGIDEVLG
TEGYMAFIGNAAEDAARQREVLVRMQEHGVDGLVVVASENTRADALEEGACARMPCVLAQ
RRVEGFPADYVGPDYGAGMELITEHLIGLGHRNIAFIGGVRRIAPLAERMAGFHRALRRH
KLKSGAVVPCAVIDRSSGYTAARELLAKGDIPSAIVCYNDVVAFGVMLALDERGLVPGRD
VAVVGCDDVDEAGLHRPALTTFTTDPRVVGREAARLLLRRIAHPDRPREEIIVPPRLVIR
QSCGAANRPTGGAR