Protein Info for GFF6710 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 104 to 127 (24 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 6 to 80 (75 residues), 46.9 bits, see alignment E=3e-16 PF00528: BPD_transp_1" amino acids 117 to 316 (200 residues), 153.3 bits, see alignment E=6.4e-49

Best Hits

Swiss-Prot: 45% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 98% identity to vap:Vapar_1215)

Predicted SEED Role

"Binding-protein-dependent transport systems inner membrane component precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF6710 ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MKKSLFRYIASRAAGMLVVLAIVAVLVFVLTRAASGDPVSVLLGDQATAADIARVQKEYG
LDKPLPVQFGYWLREVLQGNLGTSIFLQRPVTQALWERSEPTTLLALMAVAIAALIGVPC
GIVSAVFRGRVVDQLFTGIAMLGASIPSFWLGIVLIQIFAVSFGWFPVSGYGAPDAPFAE
RLHSLVLPATVLGLLNSALIIRFTRASMLDVLGEDYVRTARSKGLSESVVVLKHALRNAL
VPIVTVIGLTVALMIGGAVITETVFGLPGVGNLVVSAVLRRDYPVIQGALLVIAAIYVLI
NFSIDLLYAVVDPRVKV