Protein Info for PS417_03405 in Pseudomonas simiae WCS417

Annotation: D-alanyl-alanine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF02578: Cu-oxidase_4" amino acids 25 to 222 (198 residues), 155.9 bits, see alignment E=6.2e-50 TIGR00726: YfiH family protein" amino acids 26 to 226 (201 residues), 141.6 bits, see alignment E=1.2e-45

Best Hits

KEGG orthology group: K05810, conserved hypothetical protein (inferred from 57% identity to pfl:PFL_5190)

Predicted SEED Role

"COG1496: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9T9 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PS417_03405 D-alanyl-alanine synthetase (Pseudomonas simiae WCS417)
MQQADNLGAIPGIDHGFCSIDDPLRPEAVFICKQMHSASVIEWQAGAVPNTVEADGVYTG
EPHPIAVITADCLPILIAATNGEKVAAVHGGWKGLQGGIVANAVQRFADEGIAVDQLRVA
IGPSIKPCCYEVSEGFITQFQADQGHLWLNGRAPWSAAQPAPLLPPEIAPPHARQAGSAW
FDLSGYGVMLLQAAGIRREQIEVSKVCTYCTSPTFASYRRRTHNPEEQKTLIYSWIARLT
D