Protein Info for GFF6683 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 180 to 206 (27 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 357 to 372 (16 residues), see Phobius details amino acids 445 to 465 (21 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 10 to 269 (260 residues), 75.1 bits, see alignment E=9.1e-25 PF12040: DUF3526" amino acids 294 to 430 (137 residues), 70.9 bits, see alignment E=2.9e-23

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 90% identity to vpe:Varpa_4178)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>GFF6683 Efflux ABC transporter, permease protein (Variovorax sp. SCN45)
MKTRMLLSLVARREFLERLRDGRLYWAGGLVAVLLFTALAVGWAHQREARAEQQAAQAMD
YRDWLHQDRRHPHDAAHQGMHAFKPEAALAMIDSGINPFIGSTVWLQAHRQSEVKFNAAQ
DATGLQRFGNLSVGWILQVLGPLLVIVLGFNAFAGEREQGILRQTLSLGVPPLRLLGGKA
LALAASLAVLLVPAALVAAVAVAVGAGEGERLDALLRLAAWALGYAVYLGIFVFVVLGVS
AASSTSRMAITVLLALWIGQAVMAPRVMSELSRAWFPSPTRLAFNQALGAELKTVSDQVW
QKNFGTTERWGRDVPLSKWGIALRLDDQASYPAYDRHYGRLWDTWERQQQVQEWSGLVLP
ILAIRSFSMGMAGTDFAHHRSFTTAAELHRRRIQDLMSEDLVAHADPMGDRHFAYQAAPD
LWATVPPFDYHPPHAGWALAHQARSLAVLCAGLLLAAAFAAFATLRQRAL