Protein Info for GFF6678 in Variovorax sp. SCN45

Annotation: Putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 14 to 367 (354 residues), 96.8 bits, see alignment E=7e-32

Best Hits

KEGG orthology group: None (inferred from 80% identity to vap:Vapar_3623)

Predicted SEED Role

"inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>GFF6678 Putative inner membrane protein (Variovorax sp. SCN45)
MHTTDHAPPDRRRHDIDALRALAFLLVILYHVGMYYVAGWHWHLKSPHEAEWLRWPMAML
NLWRLDLVFLISGVSLGFLSRGQGTWGLLRDRGLRLMLPLVFGMAVIVPYQAYAQGVADG
MVAPGFGAFLLRYLPMSAPWPKQAFDGAEFGITWNHLWYLPYLFCYTALVALTLPLWNSA
AGQRVRRGFNGLRGWKLLLLPAVPLLLWTMLLASRFPPTHNLVRDFHLHSLYFTMFLYGY
WMGVDTGIWKELARLRRVSLALALAVIATFFALRAGVKGPPSGLQMDVLRVLYLWLSVSA
ILGYGHTYLNRPWPWLRWANESVYPWYMLHQTLIIAGVALLAPLALGPVAEPVLLVALTI
LGCWALTDGLIRRFNLLRPLFGLKLRPRASRRALPPEPEWRSPSPRA