Protein Info for PS417_03385 in Pseudomonas simiae WCS417

Annotation: flavin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF01613: Flavin_Reduct" amino acids 21 to 155 (135 residues), 90.7 bits, see alignment E=5.5e-30

Best Hits

Swiss-Prot: 49% identical to YDDH_ECOLI: Uncharacterized protein YddH (yddH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 78% identity to pfl:PFL_5208)

Predicted SEED Role

"NAD(P)H-flavin oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4C5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>PS417_03385 flavin reductase (Pseudomonas simiae WCS417)
MSPTHRRPVPLSKAYRLLNHGPTLLVSAAHNGQRNIMAAAWAMPLDFEPPKVAVVLDKAT
WTRQLLEGAGTFVLQVPCAAQADLVQTVGNTTGSETDKFAAYGLQTFKGEHTEAPLLEGC
VAWLECRLLPEPHNQQTYDLFLGEVVAAYADDRVFSDGRWHFEGHDELRTLHHVAGGHFL
TIGGQLQASSLTPQA