Protein Info for GFF6649 in Variovorax sp. SCN45

Annotation: Undecaprenyl-diphosphatase (EC 3.6.1.27)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details PF02673: BacA" amino acids 9 to 260 (252 residues), 297.4 bits, see alignment E=5.3e-93 TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 9 to 258 (250 residues), 246.8 bits, see alignment E=1.5e-77

Best Hits

Swiss-Prot: 92% identical to UPPP_VARPS: Undecaprenyl-diphosphatase (uppP) from Variovorax paradoxus (strain S110)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 92% identity to vap:Vapar_3599)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF6649 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Variovorax sp. SCN45)
VDIVLLVKAAIMGIVEGLTEFLPISSTGHLILAGSLLGFDDDKAKVFDIAIQTGAIFAVV
LVYWEKIKSTVVALPRQPRAQRLALNIFIGFLPAVVLGLLFGKVIKAHLFIPTVVASTFI
IGGFIILWAEKRPPGSVRVEHVDDMTPWDALKVGLVQCFAMIPGTSRSGSTIIGGMLLGL
SRQAATDFSFFLAIPTLIGAGVYSLYKERALLSVADIPLFAVGLVFSFVSAWLCVRWLLR
YISTHNFVPFAWYRIVFGIVVLATAWSGTVVWAD