Protein Info for GFF6648 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 144 to 165 (22 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 148 to 336 (189 residues), 32.2 bits, see alignment E=1e-11 PF02518: HATPase_c" amino acids 486 to 575 (90 residues), 44.6 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: None (inferred from 82% identity to vap:Vapar_3594)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>GFF6648 hypothetical protein (Variovorax sp. SCN45)
VRASGWNDTAPPAEGWMPVTLPDSWAARWPGFDGVVWYRLTWEQPEQVHEAGLLLHYLNM
AGEVSLNGTPISRDDSLVEPLTRAWNTPRYWLLAPPLLRPGTNTLLVRVSGLFAYQAGLG
PVSLGEPAAMQADFERERLIRRDLQVLGLAVSAAASAFFAALWLLRRRETAYGWFALMSV
LWLLFGYNQIATSPWPFASNHGWQALNTSTLLVFGWCYVVFALRFCGRRMPRFEGAALLV
VAAGVLDLWLAPVADLISHRAVWTLVGGLTVIVVNSTSIVHALRHRHSPMRSLAPFMAVS
ALTGAHDLLVFTQIIDSNTYYTTMSSYALLLGMALTLAAQFVKSLKRIENFNTELIEEVN
AAKADLAATLAQQHALELTHARIGERMNLVSDLHDGLGGMLVGSIAKLERTPEDLSAPEL
LAMLKHLRDDLRLIIDATGRDDGARALGELLAPMRYRSAQLLDANGIDCRWSVSNIETLE
LPASQSLDLMRFLQEALTNVLKHSASRRVDVTVARAGAELRLSVRDDGRGFVVENIDKAT
GAGLRSLRARARRLGAQLQLQSRPGETQVLLRMPLGARP