Protein Info for GFF6641 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 132 to 158 (27 residues), see Phobius details amino acids 207 to 232 (26 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details PF12911: OppC_N" amino acids 3 to 44 (42 residues), 26.6 bits, see alignment 4.6e-10 PF00528: BPD_transp_1" amino acids 105 to 287 (183 residues), 89 bits, see alignment E=3.4e-29

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 75% identity to dda:Dd703_1837)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF6641 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MSTLKRLWRNTAVRGGVVVLAVLALLGAFAPWLGTFDPSAMDPSFISVGAGTAGQVTMPD
GAQFAHTFWMGSDSVGRDVWSRVLYGTRISMTVGLFTAFVAIAFGCLLGMLAGYFRAVDA
VLMRVMDGVMAIPAVLLAITLVAVLGASLPTVILAIAVPEVPRVTRLVRALVMSLRDEPF
VEAARALATADATILWRDILPNALAPLIVQGTFIAASAVLTEAILSFLGLGLPSDVPTWG
NIMAEGRVQFSQSPGNVLFPALFLVPTVLAINMLGDGLRDVLDPKFSKRV