Protein Info for GFF663 in Sphingobium sp. HT1-2

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 4 to 320 (317 residues), 429 bits, E=5.3e-133
• PF00108: Thiolase_N
  • amino acids 48 to 145 (98 residues), 34.7 bits, E=2e-12
• PF08545: ACP_syn_III
  • amino acids 107 to 188 (82 residues), 111.5 bits, E=2.2e-36
• PF08541: ACP_syn_III_C
  • amino acids 233 to 320 (88 residues), 123.7 bits, E=4.3e-40

Best Hits

Swiss-Prot: 81% identical to FABH_SPHWW: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 90% identity to sjp:SJA_C1-32390)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (321 amino acids)

>GFF663 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) (Sphingobium sp. HT1-2)
MRRSVLLGTGSALPARVVTNAELAQTVDTSDEWIVERTGIRTRYIAGEGETTTTLATDAA
KRALEAAGLAAQDIDLIILATATPDQTFPASATLVQAALGIEDCVAFDVAAVCSGFLYAM
TVADSMIRSGAAQRALVIGAETFSRILDWEDRATCVLFGDGAGAVVLGAEESADGQRGIL
AAKLHADGRHNQLLYVDGGPSTTQTVGKVRMKGQEVFRHAVVNLATVLKEVMAMAEMTPA
DIDWLVPHQANARILDATARKLKLSPDKVVVTVDQHANTSAASVPLALDAATRDGRIKAG
DLIVLEAMGGGFTWGACVLRV