Protein Info for PS417_03350 in Pseudomonas simiae WCS417

Annotation: cytochrome C peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 44 to 356 (313 residues), 169.4 bits, see alignment E=5e-54 PF16576: HlyD_D23" amino acids 56 to 283 (228 residues), 131.2 bits, see alignment E=5e-42 PF13533: Biotin_lipoyl_2" amino acids 72 to 112 (41 residues), 25.8 bits, see alignment 1.1e-09 PF13437: HlyD_3" amino acids 181 to 280 (100 residues), 61.6 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU0698)

MetaCyc: 65% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXL6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PS417_03350 cytochrome C peroxidase (Pseudomonas simiae WCS417)
MNNRHGVALAVALGLMLSGLTRADEEEGALELTEQQIQAAGIQLAMAEPRSIGTLLTLPG
EVRLDEDRTSHIVPRAAGVVESVKVNLGQSVKKGELLAVIASQQVSDQRSELAASERRVE
LARTTFQRERQLWQDKISAEQDYLLARQTLQEAEIALNNARQKMTALSGSAGLVGGNRYE
LRAPFAGVVVEKHLGVGEVVGETSNAFTLSDLSHVWVTFGVFPKDLNKVRVGKPVNVSST
EMGTEVQGTVAFVGNLLGEQTRTATVRVSVANPDDAWRPGLFVNVQLVTDSYEAKVTVPQ
TAIQTVEEKPSVFVRTPEGFITRHLELGTSENGYVEVRQGLEAGAQVATVGSFILKSELG
KGSAEHAH