Protein Info for GFF66 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 322 to 338 (17 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 73% identity to vpe:Varpa_2876)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF66 hypothetical protein (Variovorax sp. SCN45)
MKPFSPSLALPGARMARLMGLWALVSRLYVYLSGFVAIFLMAANVSPARFGEYSIYQSVL
EVALVVGTLGSTLLFSRNATAVPPAVTQGDVVRTLAFGLPLATALVVVILTLQRLPVADV
PFVLVVVTLAVFSFNCLRLAYSRGLGHAGLLNLEAGIRSTILVLGVGICASLGFELGVAH
LLLINLFAFVVVCAAICIPPNGAAPPAGRHVLALASQASATVYSLLTFLLRKSDLLIVAF
FMPLSYVGAFKLAFLLAEAPSQFVQAFLFTKTPAMMDADPEKLAASKLQLARHSFLLGCA
LFVGLAGLITVAAPLLKMGDQARTIFLCIAPYFLLRTYTIHHEMVLSLKTSMGSLGRWAL
LEVTLRLLSYGVVILLFPGRPHYVFFIACLSDFALYETRMRLQFGFFPIVRLLRRSP