Protein Info for GFF6597 in Variovorax sp. SCN45

Annotation: Glycolate dehydrogenase (EC 1.1.99.14), iron-sulfur subunit GlcF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF13237: Fer4_10" amino acids 22 to 86 (65 residues), 32.4 bits, see alignment E=3.6e-11 PF13183: Fer4_8" amino acids 22 to 89 (68 residues), 45.5 bits, see alignment E=4.5e-15 PF13484: Fer4_16" amino acids 24 to 87 (64 residues), 30.5 bits, see alignment E=2.5e-10 PF12838: Fer4_7" amino acids 24 to 89 (66 residues), 42.4 bits, see alignment E=3.8e-14 PF13534: Fer4_17" amino acids 24 to 89 (66 residues), 41.8 bits, see alignment E=6.5e-14 PF02754: CCG" amino acids 169 to 254 (86 residues), 40.3 bits, see alignment E=1.4e-13 amino acids 304 to 388 (85 residues), 44.5 bits, see alignment E=6.8e-15

Best Hits

KEGG orthology group: K11473, glycolate oxidase iron-sulfur subunit (inferred from 84% identity to vap:Vapar_0224)

Predicted SEED Role

"Glycolate dehydrogenase (EC 1.1.99.14), iron-sulfur subunit GlcF" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.99.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.14

Use Curated BLAST to search for 1.1.99.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF6597 Glycolate dehydrogenase (EC 1.1.99.14), iron-sulfur subunit GlcF (Variovorax sp. SCN45)
MQTELAPEFQGTAEGQEAEAILRKCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQVLE
GKEPTRATQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRKIVEEKVPRPALEGALRWTLK
EALPSPLFGAAMKLGQSVRGLLPQRLKAKVPARQPAGEWPMRSHARKVLLLAGCVQPSMA
PNINSATARVLDAAGIETLVAPAAGCCGAVKFHLNDHEGGKAQMRANIDAWWPSVEEGAV
EAIVMNASGCGVTVREYAHVLRDEPAYAEKAARISALTRDLSQLLPELVPLLKDRVSAPQ
GVFAYHPPCTLQHGQKLRGGVEVNLRALGFDIQVARNEPHLCCGSAGTYSVLQPELAYSL
RDRKLDHLSQLKPDAIISANIGCITHLQSGSETPVRHWIEILDEAIDLAGSKEAHPLQGA
WDIVASRSSCLTP