Protein Info for GFF6578 in Variovorax sp. SCN45

Annotation: Conjugative transfer protein TrbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 70 to 87 (18 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details PF04956: TrbC" amino acids 24 to 115 (92 residues), 89.6 bits, see alignment E=6.7e-30

Best Hits

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 94% identity to adn:Alide_0216)

Predicted SEED Role

"Conjugative transfer protein TrbC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF6578 Conjugative transfer protein TrbC (Variovorax sp. SCN45)
MTHVDAFRISANPLSRPARLERLARPALQGLLLAALMLLLVGTAQAAGSSMPWEGPLQSI
LESIQGPVARIIAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFS
GGAVV