Protein Info for GFF6521 in Variovorax sp. SCN45

Annotation: Auxin efflux carrier family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details PF03547: Mem_trans" amino acids 4 to 309 (306 residues), 104.8 bits, see alignment E=1.9e-34

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 92% identity to vpe:Varpa_4291)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF6521 Auxin efflux carrier family protein (Variovorax sp. SCN45)
VNSFVISSLLPVVLLIAAGYLAGRRRWIGGNAVKDLSNLIFLLLAPALLFRAMSTVHVEQ
LSLKPVAAYFIASGLLFAGTMALRGFNRTAAVIALANTYSNTVMIGIALIGLAYGEDGMV
VLLTLISLHSLVLLTSATVVLELAVAREHAAAGDGTGKHSMARTVLRALRNAIIHPVPLP
IMAGLLFAQTGLVMPEMIDKPIQLLGQAFGPVALVMVGITLALTPIGRHWRGALAQALVK
NLLHPLLVAAIGWALGVRGIPLTVMVVAAALPIGANVFLFSQRYRTAEDLVTASVAVSTV
LALGTLTLVMVWVQWLP