Protein Info for GFF652 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) / UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF04321: RmlD_sub_bind" amino acids 1 to 162 (162 residues), 52.1 bits, see alignment E=2.6e-17 PF05368: NmrA" amino acids 2 to 140 (139 residues), 28.4 bits, see alignment E=6.5e-10 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 2 to 335 (334 residues), 494.4 bits, see alignment E=6.2e-153 PF08659: KR" amino acids 3 to 136 (134 residues), 25 bits, see alignment E=8.2e-09 PF02719: Polysacc_synt_2" amino acids 3 to 183 (181 residues), 59.1 bits, see alignment E=2.1e-19 PF00106: adh_short" amino acids 3 to 110 (108 residues), 27.5 bits, see alignment E=1.1e-09 PF01370: Epimerase" amino acids 3 to 262 (260 residues), 214.8 bits, see alignment E=6.1e-67 PF01073: 3Beta_HSD" amino acids 4 to 160 (157 residues), 68.1 bits, see alignment E=3.4e-22 PF16363: GDP_Man_Dehyd" amino acids 4 to 325 (322 residues), 216 bits, see alignment E=4.9e-67 PF13460: NAD_binding_10" amino acids 7 to 133 (127 residues), 34 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 100% identical to GALE_SALTY: UDP-glucose 4-epimerase (galE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 99% identity to stt:t2111)

MetaCyc: 96% identical to UDP-glucose 4-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 4-epimerase. [EC: 5.1.3.2]

Predicted SEED Role

"UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) / UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem KDO2-Lipid A biosynthesis or Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2, EC 5.1.3.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF652 UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) / UDP-glucose 4-epimerase (EC 5.1.3.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIR
NEALITEILHDHAIDTVIHFAGLKAVGESVARPLEYYDNNVNGTLRLVSAMRAANVKNLI
FSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYFNP
VGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRESLAVFGNDYPTEDGTGVRDYIHVMDLA
DGHVVAMEKLADKSGVHIYNLGAGVGSSVLDVVNAFSKACGKPINYHFAPRRDGDLPAYW
ADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD