Protein Info for GFF651 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Aspartate carbamoyltransferase (EC 2.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF02729: OTCace_N" amino acids 16 to 159 (144 residues), 142.1 bits, see alignment E=1.5e-45 TIGR00670: aspartate carbamoyltransferase" amino acids 16 to 314 (299 residues), 302.7 bits, see alignment E=1.3e-94 PF00185: OTCace" amino acids 167 to 311 (145 residues), 90.4 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 89% identical to PYRB_ACIAC: Aspartate carbamoyltransferase (pyrB) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 89% identity to aav:Aave_0910)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF651 Aspartate carbamoyltransferase (EC 2.1.3.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VQRKNPQLNKNGELIHLLSTEGLSRDILTQILDTAANFTSVSNREVKKVPLLRGKSVFNL
FFENSTRTRTTFEIAATRLSADVINLDIARSSTAKGESLLDTIANLSAMAADIFVVRHSE
SGAPYLISQHVAPHVHVVNAGDGRHAHPTQGLLDMYTIRHYKKDFTQLSVAIVGDVLHSR
VARSDIHALTTLGCPDVRVVGPRTLVPSDLSHMGVRVCHTLEEGIKDCDVVITLRLQNER
MSGALLPSSQEYFKSFGLTPERLRWAKDDAIVMHPGPINRGVEIDSAVVDGPQSVILPQV
TYGIAVRMAVMGIVAGNEA