Protein Info for GFF6501 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 384 (362 residues), 97.5 bits, see alignment E=7.8e-32 PF00083: Sugar_tr" amino acids 24 to 232 (209 residues), 74.7 bits, see alignment E=7.5e-25

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_2300)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>GFF6501 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MATNTAHEPQGRHQSKKAAASGWIGSALEYYDFFIYATAAALIFPQIFFPKGDPKTAIIA
SLATYGVGYVARPIGAFVLGHWGDTHGRKQVLVLCMFLMGFSTVAVGLLPTYDQVGLLAP
VLLVLLRLVQGFAVAGEISGASSMILEHAPFGRRGFFASFTLQGVQAGQILAAAVFLPLA
HYMPEESFNSWGWRIPFLLSFLVIVAGYIIRREVDETPAFAEVDKKGEVAKAPIIQAFTD
SWADMLRVVCMALMNVIPVVATVFGAAYAVQAAYGIGFQKDVYLWIPVLGNILAVLVIPY
VGNLSDRIGRRPPIIVGALLSGLLSFVYLYAISIRNVPLAIAMSLLMWGIVYQGYNATFP
SFYPELFRTRNRVSAMAISQNIGTTITALLPALFAAVAPPGSTNVWFTVGAITFAVTVLA
ALAALSARETYRIRMNDLGKPDAVPVDKQEYDRLREQTLQDARLAKAAA