Protein Info for GFF65 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Predicted secretion system X protein GspF-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 164 to 186 (23 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details PF00482: T2SSF" amino acids 64 to 187 (124 residues), 95.1 bits, see alignment E=1.6e-31 amino acids 267 to 387 (121 residues), 87.2 bits, see alignment E=4.3e-29

Best Hits

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 58% identity to tbd:Tbd_1294)

Predicted SEED Role

"Predicted secretion system X protein GspF-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF65 Predicted secretion system X protein GspF-like (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRYLVKSLQPDLSMAVSAIDAATADDARRQVHALGHSVVSVSRERGWTPGAARGASAAFP
LLLFSQELLSLLSSGVSIVEAVETLAEKESRAPVRAVLQQILLSLREGQTFSGALQALPQ
NFPPLYVATVRASERTSNLGEALGRYIAYATQLETLRGKLVSAAIYPAMLIGVSSLVILF
LMGYVVPRFSHIYEDMGDQLPFMSRLMLQWGQAVEQHWPVLLGLMVALGAALVSGGGRWL
AQRIAGQLWRIPAVGERMRVFQLARLYRTLGMLLRGGIAIVPALEMVGGLLSPALQPRLL
AATGRIREGQPMSQAFEAQGLSTAVSLRMLRVGERTGNMGEMMERAAAFHDEELARWAEW
ATRLLGPALMLIMGLVIGAIVVLMYLPIFQLAESVQ