Protein Info for GFF65 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ErpA, essential respiratory protein A / probable iron binding protein from the HesB_IscA_SufA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00049: iron-sulfur cluster assembly accessory protein
  • amino acids 9 to 113 (105 residues), 130.9 bits, E=1e-42
• PF01521: Fe-S_biosyn
  • amino acids 9 to 109 (101 residues), 74.8 bits, E=3.2e-25

Best Hits

Swiss-Prot: 100% identical to ERPA_SALDC: Iron-sulfur cluster insertion protein ErpA (erpA) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: None (inferred from 99% identity to eco:b0156)

Predicted SEED Role

"ErpA, essential respiratory protein A / probable iron binding protein from the HesB_IscA_SufA family"

Protein Sequence (114 amino acids)

>GFF65 ErpA, essential respiratory protein A / probable iron binding protein from the HesB_IscA_SufA family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDM
TIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI