Protein Info for GFF6494 in Variovorax sp. SCN45

Annotation: protein of unknown function DUF1232

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 59 (2 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details PF06803: DUF1232" amino acids 34 to 69 (36 residues), 49.6 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 74% identity to axy:AXYL_00092)

Predicted SEED Role

"protein of unknown function DUF1232"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>GFF6494 protein of unknown function DUF1232 (Variovorax sp. SCN45)
MRVSDKLKAWAKRIKRDGVTLWFAGKNPRTPWYAKALGVFVVAYALSPIDLIPDFIPVLG
YVDDVLLLPVLIWLAIRLLPPEVLAECRSRAEEWMQANRSKPSSRAGALLVVMLWLGSGV
AAWLWFKPHL