Protein Info for GFF6469 in Variovorax sp. SCN45

Annotation: TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF04290: DctQ" amino acids 30 to 152 (123 residues), 99.2 bits, see alignment E=9e-33

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_3296)

Predicted SEED Role

"TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>GFF6469 TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter (Variovorax sp. SCN45)
VKEKFLGIERWTTGASMVGACLMLVIASALGVFQIVTRFVLEQPAEWSEILIRVSLIWMV
FLGIPMAFRQGAMVSVDVLYRWSPPRVRRVLDAVVSVAALTLMLIVLWWGWDYAMRGRVQ
SMAGLESISMVWAYLALPVGSVFCLFGIAGNYLDPKRLELETAQ