Protein Info for GFF646 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 235 to 261 (27 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF01032: FecCD" amino acids 9 to 322 (314 residues), 274.6 bits, see alignment E=4.9e-86

Best Hits

Swiss-Prot: 39% identical to HMUU_YERPE: Hemin transport system permease protein HmuU (hmuU) from Yersinia pestis

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 99% identity to spt:SPA1982)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF646 Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLAIALAMMASLMVDVTCGSSGLPLSALWQALFQPEKVNAGIHVIVWDIRLPYALMALLV
GMALGLAGAEMQTILNNPLATPFTLGVSSAAAFGAALAIVLGIGIPGIPAAWFIPANAFI
FALLSALLLDGITRWTGVAASGVVLFGIALVFTFNALVAIMQFVADEDTLQGLVFWTMGS
LVRASWEKLGVLAVVFIAVLFCALRSAWQLTALRLGEERAMSFGIHVRRLRLLSLLRISL
LSALAVAFVGPIGFIGLVAPHIARILLGEDHRFYLPGSVLIGGLVLSLASIAAKNSIPGV
MVPVGIVTSLVGVPFFLSIVLRHRGSL