Protein Info for GFF6458 in Variovorax sp. SCN45

Annotation: Lipid A 4'-phosphatase LpxF-like, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 61 to 78 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details PF01569: PAP2" amino acids 90 to 214 (125 residues), 46 bits, see alignment E=2.2e-16

Best Hits

KEGG orthology group: None (inferred from 73% identity to vpe:Varpa_2346)

Predicted SEED Role

"PAP2 (acid phosphatase) superfamily protein-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>GFF6458 Lipid A 4'-phosphatase LpxF-like, putative (Variovorax sp. SCN45)
MTRASNFRLGLLTLFALAAVLAWDATGWDLALARLSGSPFGFVWRENPFLVHVMHNGARD
LSWALLTALFIAIRWPVGVLRRLGTGDRVQLALATLAAVVAVSLIKHASDTSCPWDLKEF
GGVARYVSHWTWDVSDGGPGGCFPAGHASAAFAYMGGYFVLRRVSARAAGIWLAVAVVAG
LALGLSQQVRGAHYMSHTLWTAWICWTVGFAIEVVFGRFNPKVLEPAVPVHAGY