Protein Info for PS417_03275 in Pseudomonas simiae WCS417

Annotation: mammalian cell entry protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 767 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF02470: MlaD" amino acids 41 to 134 (94 residues), 55.6 bits, see alignment E=2.6e-19 amino acids 157 to 217 (61 residues), 45.2 bits, see alignment 4.6e-16 amino acids 280 to 371 (92 residues), 53 bits, see alignment E=1.7e-18 amino acids 396 to 457 (62 residues), 38.8 bits, see alignment 4.5e-14 amino acids 520 to 608 (89 residues), 45.8 bits, see alignment E=3e-16 amino acids 635 to 694 (60 residues), 35.8 bits, see alignment 4e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU0679)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZB3 at UniProt or InterPro

Protein Sequence (767 amino acids)

>PS417_03275 mammalian cell entry protein (Pseudomonas simiae WCS417)
MSDLPKAKTRPASNWSAIWVLPLIALIIGGWLGWRAYSQQGIDIQVRFESGEGIQVNKTE
VVYKGMPVGKVKALALDDEGNNRGVIATIEMNKDVDQYLKTNTRFWLVKPSVSLAGITGL
ETLVSGNYIAASPGDGEPTRKFKALSEEPPLSDAKPGLHLTVKADRLGSLNRGSPVFYKQ
IQVGQVKSYLLSEDQSTVEIKVYIEPTYASLVRKHTRFWNASGISIDANLSGVKVRSESL
SSIVAGGIAFATPENRKDSPPTDPSLPFRLYEDFDAAAAGIRVKVKLTDFEGLQAGRTPV
MYKGIQVGSLKTLKVDPDLSSANAELTLDPLAEDYLVQDTQFWVVKPSISLAGITGLEAL
VKGNYIAIRPGDKGTAPQREFVARAKAPPLDLRSPGLHMVLFTDNLGSLDVGSPILYKQV
KVGSVQSYQFSRKNKQLVIGVHIEKEYENLVNGSTRFWNASGVTLTGGLTGGIQVKSESL
ASLMAGGIAFETPEPNVPLKKRIPRFRLFADREAANQHGTLVTIKVDRADGMRPGTPVRF
KGLDVGKIESVDLSADMQSVLLSARITQVADRIARAGSQFWVVKPELGLMKTSNLETLVT
GQYIEVLPAAKNAGPQKSFVALDQPPEAVHQEAGLSLTLSAARRGSLKEGVPVTYREVTV
GKVTGYELGQTADRVLIHILIEPKYAPLVRSGSRFWNTSGFGLDFGLFKGATVRTESLET
LVAGGIAFATPDGERMGNPARPQQTFALFDKFEDEWLTWAPKIPLGK