Protein Info for GFF6421 in Variovorax sp. SCN45

Annotation: ATPase, AAA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 PF05496: RuvB_N" amino acids 294 to 338 (45 residues), 28 bits, see alignment 1.6e-09 PF07728: AAA_5" amino acids 313 to 445 (133 residues), 26.5 bits, see alignment E=5.6e-09 amino acids 567 to 633 (67 residues), 26.4 bits, see alignment E=6e-09 PF00004: AAA" amino acids 314 to 451 (138 residues), 53.9 bits, see alignment E=2.4e-17 amino acids 567 to 688 (122 residues), 101.1 bits, see alignment E=6.3e-32

Best Hits

KEGG orthology group: None (inferred from 96% identity to vpe:Varpa_0175)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (774 amino acids)

>GFF6421 ATPase, AAA family (Variovorax sp. SCN45)
MAKRAGVDVVAAAVRGQALPSPGLKEAPVLELMCSHFVLTLAAKQGPRFNVRRDINGLLS
LTGRHLVWPAAVLQRLREFLGRRCAGNEAWKGVEAFDGRTLLERHGVWRGPYEEGTLFFY
LDEYAKDQPKDLLSVLAVTRDWLTHALRKQSTLVEKNIDALAGLLQLNKAERALLLYGTL
ARYQRDLRSLLVEFKVNNAPEAYAAIADIAGVNASEVGEALRAGSRLERIGLVENLISEH
NITDLADLMKVSEKLPPVLMREYRDHNELMAVFTRPSAKSTLTPHDFSFVQEDAQMLVTL
LRAAVARKEPGVNVLLYGPPGTGKTELAKVVAQAAGLELFEVEYADRDGNSLSGRDRYRS
LQIAQVFLKGSAQAALLFDEVEDVFPPISTEAAQFMARAEQIPAPTSGSVSGKAWVNQIL
EANPVPTLWVTNRIEQIDPAFRRRFAYHLELKSPPPGAREQLVKKTLEGVVVSEAFTAKL
AERKGLTPAQIRTAVRFAGLAKTDDASVEALIERQLRNADLALGTLDTGRGERRSVTTYD
LDMLNVETRFEIPRIAQALKARGHGTLCFYGAPGTGKTALAEHIAKALGRPLLVKQASDL
MSKYVGETEQNMAAMFREAENEKAVLLLDEADSFLQDRRGAQRTYEVTEVNEMLQGMERF
NGVFVCTTNLLDRLDQAALRRFTFKIKFMPLTAVQRERMFVTEALAGDAERITSAIRARL
AQLTQLCPGDFAAVKRQTDILAAEFSAVEFLDQLEAEHRIKPEVRESRGMGFLQ