Protein Info for GFF6412 in Variovorax sp. SCN45

Annotation: Histidine ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 274 (170 residues), 91.7 bits, see alignment E=2.5e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 94% identity to vpe:Varpa_0180)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>GFF6412 Histidine ABC transporter, permease protein (Variovorax sp. SCN45)
MTQVPSAAAVAAPAVVVPARRRALAPLEPIGTRARVLLGLAFFVVFVLVWAIATLGGFVP
PTFLASPPTMVKEGWLLFTEYGFIGDIGMTVWRVFGGFLLAAVFAVPLGIAMGTWKTVEA
FFEPFVSFCRYLPASAFIPLLILWAGLGEMQKLLVIFIGSFFQIVLMVAVTVGGARRDLV
EAAYTLGANSRGIVARVLIPGAAPGIAETLRLVLGWAWTYVIVAELIGSSSGIGHMITDS
QALLNTGQIIFGIIVIGVIGLLSDFAFKALNRRLFAWAAL