Protein Info for GFF6366 in Variovorax sp. SCN45

Annotation: T6SS component TssG (ImpH/VasB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF06996: T6SS_TssG" amino acids 60 to 359 (300 residues), 339.2 bits, see alignment E=1.1e-105 TIGR03347: type VI secretion protein, VC_A0111 family" amino acids 62 to 359 (298 residues), 333 bits, see alignment E=7.6e-104

Best Hits

KEGG orthology group: K11895, type VI secretion system protein ImpH (inferred from 86% identity to vap:Vapar_0199)

Predicted SEED Role

"Uncharacterized protein ImpH/VasB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>GFF6366 T6SS component TssG (ImpH/VasB) (Variovorax sp. SCN45)
MSEEGFTDDMAALPVSDGEAEQDNAADVCYSIPQSLQATPLPRGLPEADPELWAQLLDQP
FGHDLFMLLRRLDARSDHPLLGRAPRPVDEPLRLGQEPSMAFAPSNVAGVDASQDGPPRI
SIYGFGLFGPNGPLPLHMTEYARERKRHHADDTLSAFADLFHHRLILLFYRAWADAQSVN
SLDRPDGHRFVDYVASLMNMGQPGLKGRDRIADHARTFMAGHLVRQTRNPEGLIQILRLY
FDVPVRIEEFVSDWVRIDERQLSTLGFSGRNHQLGGGATVGIAVRDAQSKFRVELGPLSQ
QEFQELLPGSKRLRQVVDWVRQYVGIEFAWELRLVLRKQDAHGMQLGAGQQLGWGSWLGT
RLADTDAGDMVFQPEALFSRSASAASANSSS