Protein Info for GFF6322 in Variovorax sp. SCN45

Annotation: Glutathione synthetase (EC 6.3.2.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF02951: GSH-S_N" amino acids 3 to 121 (119 residues), 145 bits, see alignment E=1.6e-46 TIGR01380: glutathione synthase" amino acids 4 to 312 (309 residues), 408.8 bits, see alignment E=6.2e-127 PF02955: GSH-S_ATP" amino acids 125 to 298 (174 residues), 236 bits, see alignment E=2.8e-74 PF08443: RimK" amino acids 157 to 309 (153 residues), 33.3 bits, see alignment E=5.7e-12

Best Hits

Swiss-Prot: 56% identical to GSHB_NEIMB: Glutathione synthetase (gshB) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 96% identity to vpe:Varpa_0454)

MetaCyc: 49% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF6322 Glutathione synthetase (EC 6.3.2.3) (Variovorax sp. SCN45)
MKNILFVADPLDHFKIYKDTTFSMMREAQRRGHRIAACLPQDIQWKSGGFVTATVQQITL
TGDAKDWYRVDITESKALKDFDAVLMRKDPPFDAEYIYATHLLEQAEREGGRVVNSPRAL
RDHPEKLAIMEFPQFVTPTLVTRSAQAVRDFHAEHGDIILKPLDGMGGMGIFRVKQDALN
LGSIVETLNKDGAETIMVQRFVPEVVQGDKRILIIAGEPAPFVLARIPQGTEVRGNLAAG
GKGVAQPLTARNREIAETIGRVLAPRGLLLIGLDVIGDSVTEINVTSPTCFQEITEQTGF
DVPAMFIDALEATLRAQGR