Protein Info for GFF6318 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details amino acids 467 to 488 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 33 to 459 (427 residues), 230.5 bits, see alignment E=1.9e-72 PF07690: MFS_1" amino acids 38 to 435 (398 residues), 161.7 bits, see alignment E=1.2e-51

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_0459)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>GFF6318 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MTSPQTPEAAVAPAPPSIGSMRQRYGERYRWYLLLSVMVGTMASIMSSTIVNVAIPGMSH
HFSLGQERAQWVSSGFMVAMTVSMLTTPWLLSRYGYRRTYVGTMLLLLVGGIVGGVANDF
SLVLFARVAEGLAAGVVQPIPAIIILRAFEPHEQGRASGIFGMGVVLAPAIGPSIGGVLV
DLFGWRSIFFMVVPFCLASLWLAYKFVPTTAPGGVAAVRGGGLDGRGLALGTIGTLCLLN
GLVALRGDSPLQAALLLAGALVAFGAFVWWQRRLAASGGTPLMNLALFQYRQFAMGSVVA
FIYGTALFGSTYLLPVYMQVGLHLSASHVGTILLPAGIVLAVTIAGVGRLADRHPTWVLV
TIGLALLASSFALMMVLRLDSALWLLVAFAIIGRIGLGFILPSLNLGSMRPLAKPLIPQG
ASAINFVRMLGGAAGVSLCAIVLEWRLAAHGDSLANPMSSPARLAAFDEVFAMLAGLCAL
AICAAWQLRQGPAETAHKTG