Protein Info for GFF631 in Xanthobacter sp. DMC5

Annotation: Protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF01135: PCMT" amino acids 18 to 217 (200 residues), 192 bits, see alignment E=2.3e-60 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 18 to 219 (202 residues), 193.1 bits, see alignment E=2.7e-61 PF13847: Methyltransf_31" amino acids 87 to 166 (80 residues), 28.6 bits, see alignment E=2.2e-10 PF13649: Methyltransf_25" amino acids 90 to 161 (72 residues), 31.7 bits, see alignment E=4.1e-11 PF08241: Methyltransf_11" amino acids 91 to 163 (73 residues), 22.4 bits, see alignment E=3.2e-08

Best Hits

Swiss-Prot: 87% identical to PIMT_XANP2: Protein-L-isoaspartate O-methyltransferase (pcm) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 87% identity to xau:Xaut_4414)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF631 Protein-L-isoaspartate O-methyltransferase (Xanthobacter sp. DMC5)
MDTGMSTGEGDGEQAERAAFILRLRQRGIRDLAVLRAIELVPRPLFVDPMMRRHAYDDVA
LPIACGQTMSQPSLVAAMTEALGVTADQTVLEVGTGSGYQAAVLSHLAARVVTVDRYRSL
VSEAQTRFEVLGLRNVTAYVGDGMNGMPARAPFDRILVTAAATDIPAALMDQLKLGGVIV
APLGAPEEVQTLVRIVKEQSGRSRTDLMKVRFVPLVPGAAATL