Protein Info for GFF6283 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details PF00512: HisKA" amino acids 231 to 298 (68 residues), 33.5 bits, see alignment E=5.2e-12 PF02518: HATPase_c" amino acids 339 to 452 (114 residues), 94.5 bits, see alignment E=8.5e-31 PF00072: Response_reg" amino acids 481 to 588 (108 residues), 61.2 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_0490)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>GFF6283 hypothetical protein (Variovorax sp. SCN45)
MNPILVPPTAPVAPAAAGSDRFAIECEVLRLSVRPIGPVLLVQYLLNCGVAALFAWQYSL
ARALVWIVLITMVTALRGFFPQRLPEPFTPVTLRAAQRLHTLRTGIWELAHGLAGVLLFN
PARADQQLLLGLILMGMTLSSAFSVSFYTPATQLAITLLLAPVIVTGLWMGAPEMVAVAV
IGIGLTAMMWKLVAERSRQLEENIGLRLNERTLREQALAGLRASEQAQAERLRFFSAANH
DLRQPVMAIGLQAEVLRQQLESGADTHAVQHTVASLARAQQALEGLTNQLLEIGRIEAAV
DPLRPEAVALAPLLQELARQAGNGRVGVRCPTNAVAWTDTVSLRRVLANLVDNAVKFTPR
GRVLLAVRTRERESGRAWRIEVRDSGIGIPADAQERVFNDFEQIGNVERNLQRGHGLGLA
IVRRLAAQLGIEVALRSAPGRGSVFSFELPAAPEGAAVARIRPLPQAGTGASHALPSGLA
VLVVEDNAVVADSLLALLRQWGVAPRVYASAAEALALADLHALDAALCDIRLPGALDGIA
LAERLQRQKPSLTIVLISADINEATQRLALERGWHALRKPVQPDELHGVLLKALPRG