Protein Info for PS417_03185 in Pseudomonas simiae WCS417

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 2 to 337 (336 residues), 569.1 bits, see alignment E=1.9e-175 PF08240: ADH_N" amino acids 29 to 112 (84 residues), 49.2 bits, see alignment E=8.2e-17 PF00107: ADH_zinc_N" amino acids 161 to 277 (117 residues), 47.4 bits, see alignment E=2.7e-16 PF13602: ADH_zinc_N_2" amino acids 194 to 334 (141 residues), 66.5 bits, see alignment E=7.3e-22

Best Hits

Swiss-Prot: 40% identical to ZDH1_STAAW: Zinc-type alcohol dehydrogenase-like protein MW2112 (MW2112) from Staphylococcus aureus (strain MW2)

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU0663)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1N8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PS417_03185 NADPH:quinone reductase (Pseudomonas simiae WCS417)
MKAIAYYASLPINDPNALQDIELPAPVAGPRDLLVEVKAISVNPVDTKVRQNVAPEKGAA
KVLGWDVAGVVKAVGSDVTLFKAGDNVFYAGSLVRPGGNSELHTVDERIVGHMPKSLGFA
EAAALPLTAITAWELLFERLQVQEGQQDNGQSLLIVGAAGGVGSILTQLASQLTGLKVIG
TASRPETQEWTKALGADLVIDHSQPLSDALKAAGHPQVTHVASLTQTDHHLDQLVEALQP
QGKLALIDDPKTLDVSKLKRKSLSLHWEFMYTRSMFETPDMIEQHNLLNRVAELIDAGTL
KTTVGEHFGAINAANLRRAHALLESGKAKGKIVLEGF