Protein Info for GFF626 in Sphingobium sp. HT1-2

Annotation: Efflux ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 230 to 254 (25 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 17 to 273 (257 residues), 159.8 bits, see alignment E=1.2e-50 PF00005: ABC_tran" amino acids 348 to 497 (150 residues), 111.1 bits, see alignment E=6.8e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 83% identity to sjp:SJA_C1-07380)

Predicted SEED Role

"ABC-type multidrug transport system ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>GFF626 Efflux ABC transporter, permease/ATP-binding protein (Sphingobium sp. HT1-2)
MLWRFATRYPARIAGALTALIVSSAATLAIPSGFRLVIDKGFTGGGDISRWFEYLFLLVV
ILALASALRFYFVSWLGERVVADIRSATQANLLRQAPAFFEENRPSEIASRMTADTAIID
QVVGSTVSVALRNLVTGIGGLIYLFVLAPKLAGLLILGIPVIVLTLVTLGRRVRKLSRAS
QDRLAEVGSVTTEVLGAMKIVQGFGQEGREAARFDATVANGFATARQRILLRAVMTAIAF
ALVFGSITGVLWLGAIDVAAGRLSGGSIAAFVLTGGLVAGAFGSLSESWGDLLRGAGAAS
RLDELMAAEPAIAAPAAPVAIPTLPQGARLRFDNVHFHYPTRPDQAALNGVTIDIAPGET
VAVVGPSGAGKSTLIQLALRFYDPDQGEVQLNDVPLPAADPAALRAAMAMVPQDSVIFAA
SARDNLRYGKWDASDEEIWAAARAANAEAFLRALPQGLDSHLGEGGARLSGGQRQRVSIA
RALLRDAPILLLDEATSALDAESEQLVKDALDRLMQGRTTIVIAHRLATVRAADRIIVLD
QGRIVEQGDHATLVALGGLYARLASLQFQDQLDG