Protein Info for GFF6252 in Variovorax sp. SCN45

Annotation: Phosphonate ABC transporter permease protein PhnE (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 83 to 108 (26 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 26 to 266 (241 residues), 307.4 bits, see alignment E=3.9e-96 PF00528: BPD_transp_1" amino acids 96 to 266 (171 residues), 77.1 bits, see alignment E=7.3e-26

Best Hits

Swiss-Prot: 71% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 93% identity to vap:Vapar_6089)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF6252 Phosphonate ABC transporter permease protein PhnE (TC 3.A.1.9.1) (Variovorax sp. SCN45)
MQPTVQIPRMPPASAAPKRNLAWQLSWAALLIVLAASWNGADMRPLDLWRDSGNMATYAA
EFFPPNFTHWRMYLQEMVVTLQIALWGTVLAVVTAVPLALLASANIVPWWVYQPMRRLMD
SCRAINEMVFAMLFVVAVGLGPFAGVLALWVHTTGVLAKLFAEAVEAIDPQPVEGIRSTG
ASALHEIVYGVLPQVMPLWISYALYRFESNVRSASVVGMVGAGGIGVVLWEIIRGFQYAE
TCAVMLIIVVSVSVIDLVSARIRKLLI