Protein Info for GFF6246 in Variovorax sp. SCN45

Annotation: Ribulose-phosphate 3-epimerase (EC 5.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 7 to 209 (203 residues), 275.5 bits, E=2e-86
• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 7 to 222 (216 residues), 292 bits, E=1e-91

Best Hits

Swiss-Prot: 63% identical to RPE_HAEIN: Ribulose-phosphate 3-epimerase (rpe) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 98% identity to vpe:Varpa_0528)

MetaCyc: 62% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• heterolactic fermentation (15/18 steps found)
• Rubisco shunt (9/10 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Protein Sequence (231 amino acids)

>GFF6246 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) (Variovorax sp. SCN45)
MSTPFRIAPSILSADFAHLGKELTDVIAAGADWIHFDVMDNHYVPNLTFGPMICQALKPY
AKTADGTPVPIDVHLMIQPVDALAASFAQAGADYISFHPDASPHVHRSIQAIKAAGCKAG
LVFNPGLGLEALDWAIDDIDLILIMSVNPGFGGQSFIDSALRKIEMARKRIEQSGRDIRL
EVDGGIKVDNIARVASAGADTFVAGSAIFNAKDYGAVIGDMRKQLAGVVSG