Protein Info for GFF6243 in Variovorax sp. SCN45

Annotation: Ku domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR02772: Ku protein" amino acids 11 to 275 (265 residues), 305.3 bits, see alignment E=1.9e-95 PF02735: Ku" amino acids 19 to 203 (185 residues), 166.4 bits, see alignment E=3.6e-53

Best Hits

Swiss-Prot: 57% identical to KU_PSEAE: Non-homologous end joining protein Ku (ku) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 85% identity to vpe:Varpa_0531)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF6243 Ku domain protein (Variovorax sp. SCN45)
MPVSKKAPAPRVLWKGAISFGLVHIPVALYSATTDHGIDFDWLDKRTMDPVGYKRINKKT
GKEIAREQIVKGIEYEDGEYVVLSDKEIAAAYPKTTQTIEIETFVPADGIPFVYLERPYY
VAPINRGAKVYALLRETLQRSGRVGVARVVIQTKQHLAVLVPAGPGLVLNLLRWGADIRP
WTDLPLPSEDAKKAGLSERELKMAKELVDDMSTDWDPDEFKDEFKDEILRLVDKKVKAGQ
TETVTQPEPEESQSTEGRGAKIIDLTELLQRSLRGKGGKTAKAAAADEEDEEDEAPPPKA
AAKKRKPAAKAARKAPVRHRKAA