Protein Info for GFF624 in Xanthobacter sp. DMC5

Annotation: GTPase Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00231: small GTP-binding protein domain" amino acids 89 to 246 (158 residues), 84.5 bits, see alignment E=7.1e-28 TIGR00436: GTP-binding protein Era" amino acids 91 to 361 (271 residues), 236.5 bits, see alignment E=3.5e-74 PF10662: PduV-EutP" amino acids 93 to 249 (157 residues), 34.4 bits, see alignment E=7.2e-12 PF02421: FeoB_N" amino acids 93 to 246 (154 residues), 51.9 bits, see alignment E=2.6e-17 PF01926: MMR_HSR1" amino acids 93 to 207 (115 residues), 83.9 bits, see alignment E=3.5e-27 PF00009: GTP_EFTU" amino acids 94 to 255 (162 residues), 34.7 bits, see alignment E=5.7e-12 PF07650: KH_2" amino acids 290 to 366 (77 residues), 64 bits, see alignment E=3.7e-21

Best Hits

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 86% identity to xau:Xaut_3882)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF624 GTPase Era (Xanthobacter sp. DMC5)
MAPRKKAGADTAAPDQSPAVAEEEALAAAASQEDVAEEDIAEDELLNDDLPEDDLPEDDL
PEDDEDDDFDDELDREERGPLAPLEGPTRCGFVALLGAPNAGKSTLTNALVGTKVSIVSH
KVQTTRSIVRGIALDGAAQVVLVDTPGIFAPKRRLERAMVSSAWTHAADADVIALLVDAN
RGLDEDIEALLGQLKDIRKPRALILNKIDLIRRDSLLALAAAITERVPFDRVFMVSALTG
DGVMDVRRWFAETVPPGPWLYPEDQVSDAPMRMLAAEITREKMFLRLHDELPYRSTVETE
SWKELRNGSVRIEQTIFVERESQRKIVLGKGGNTIKTISTESRKEISEIIEQPVHLFLFV
KVRESWADDPERYREMGLEFPKGG