Protein Info for GFF624 in Sphingobium sp. HT1-2

Annotation: L-alanine-DL-glutamate epimerase (EC 5.1.1.n1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 270 to 283 (14 residues), see Phobius details PF02746: MR_MLE_N" amino acids 11 to 109 (99 residues), 31.6 bits, see alignment E=1.7e-11 PF13378: MR_MLE_C" amino acids 130 to 286 (157 residues), 105.9 bits, see alignment E=2.6e-34

Best Hits

KEGG orthology group: None (inferred from 89% identity to sch:Sphch_2892)

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.5.1.1

Use Curated BLAST to search for 5.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF624 L-alanine-DL-glutamate epimerase (EC 5.1.1.n1) (Sphingobium sp. HT1-2)
MTRIISATVERWPVAGAFIISRGAKTEVDVVVCTVGDGDHVGRGEGTAIYYEGETAQGCA
AAINAYAGPLDREALLQAMPRGAARNALDCALWDLEAKRAGVPVWQLAGLAAPTPLPTAF
TISLGEPERMEADARAAVARGFGLLKCKLTGEGDHARIAAVRAGAPGVRLIVDANESWHD
RDIVAEAAALAELGVEMVEQPILHGREDRLTGLRAPLPLCADESCHTRADLDRLGDFDAV
NIKLDKAGGLTEALALAQAARARGFRIMVGCMLGTSLGIAPAALVAQGADWIDLDGALLL
AKDRDGALPLRDGLLHPGTLWGQG