Protein Info for GFF6221 in Variovorax sp. SCN45

Annotation: T6SS associated component TagF (ImpM)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR03373: type VI secretion-associated protein, BMA_A0400 family" amino acids 16 to 151 (136 residues), 120.7 bits, see alignment E=2.4e-39 PF09867: TagF_N" amino acids 16 to 152 (137 residues), 138.6 bits, see alignment E=6.5e-45

Best Hits

KEGG orthology group: K11890, type VI secretion system protein ImpM (inferred from 75% identity to vpe:Varpa_0554)

Predicted SEED Role

"Protein phosphatase ImpM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF6221 T6SS associated component TagF (ImpM) (Variovorax sp. SCN45)
VSAAFFPLLASAALPGWFGKLPGMGDFAHRRLPEAFRSVWDQWLQRGLARLKDRHADWIE
RYLEAPIWCFALGPRVVGERGWIGVLMPSVDGVGRYFPFTLAVELDGDHRTELRGEALAA
ALEWWALAVRAALEGLEGDLDAVRFDAVLQRLFPAGGEAGRELLVEVLELPVAGASLWLG
DPADEAGVRMVGEGLPLDEKFDVLFLGFAGEE