Protein Info for GFF618 in Xanthobacter sp. DMC5

Annotation: Quinone oxidoreductase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF08240: ADH_N" amino acids 29 to 111 (83 residues), 65.3 bits, see alignment E=7.9e-22 PF00107: ADH_zinc_N" amino acids 153 to 258 (106 residues), 87.7 bits, see alignment E=1e-28 PF13602: ADH_zinc_N_2" amino acids 186 to 320 (135 residues), 64.2 bits, see alignment E=3.7e-21

Best Hits

Swiss-Prot: 52% identical to QOR_PSEAE: Quinone oxidoreductase (qor) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 90% identity to xau:Xaut_3872)

MetaCyc: 45% identical to 2-haloacrylate reductase (Burkholderia sp. WS)
RXN-14536 [EC: 1.3.1.103]

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.3.1.103 or 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF618 Quinone oxidoreductase 1 (Xanthobacter sp. DMC5)
VVMVHAVQVHQTGGPEVLTYEEVVVPPPGPGQVQVRHTAIGLNFIDVYFRTGLYKAATMP
FIPGNEGAGVVEAVGPDVTDFHPGDRVAYAMTIGAYAELRNVPAAALVHLPAAIDDRTAA
AMMLKGMTAQYLVRRTHHIKPGDVILVQAAAGGVGLILCQWAKHLGATVIGTVGSKDKGE
LALANGCDEVILYRDEDFVHRVKEITSGKLCDVVYDGVGQATYPASLDCLKPLGLFVSFG
NASGAIKNFDLLHLSAKGSLFATRPTLGTFVAKRADLIATANDLFEAVLTGAVKIPIHQT
YALKDVQKAHRDLEGRNTTGATLLLP