Protein Info for GFF6143 in Variovorax sp. SCN45

Annotation: 2-aminoethylphosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR03265: putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein" amino acids 20 to 372 (353 residues), 517.6 bits, see alignment E=9.2e-160 PF00005: ABC_tran" amino acids 36 to 178 (143 residues), 124.1 bits, see alignment E=9.4e-40 PF08402: TOBE_2" amino acids 292 to 371 (80 residues), 21.5 bits, see alignment E=3.2e-08

Best Hits

Swiss-Prot: 44% identical to POTA_ROSDO: Spermidine/putrescine import ATP-binding protein PotA (potA) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 94% identity to vpe:Varpa_1734)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>GFF6143 2-aminoethylphosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1) (Variovorax sp. SCN45)
MDMTDTKFIASPVPASAPAALEIVGVRKDFESFSALRDVHLRVNPGEMLCFLGPSGCGKT
TLLRIIAGLETQTSGQILQNGKDVSWLPPDRRDYGIVFQSYALFPNLSIAENIGYGLVNS
RARRGEIKTRVEELLKLVGLPTSGGKYPSQLSGGQQQRVALARALATRPGLLLLDEPLSA
LDALERIRLRGEIRRLQKQVGITTIMVTHDQEEALSMADRIVVMNHGVIEQVGTPMEVYE
QPATPFVADFVGKVNVLRAVALGNHRFRVGDMELQCDACDGAFEPGEAVNLYLRPEDRAV
EHLSHDTANRLQALVTKVEFLGGLCIAEVTADALHGQALGLHFSLNQLHDLDIREGNTID
IALRANRIRAFSARTPKP