Protein Info for GFF611 in Sphingobium sp. HT1-2

Annotation: Dehydrogenase molybdenum cofactor insertion protein, XdhC/CoxF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 156 to 178 (23 residues), see Phobius details amino acids 233 to 248 (16 residues), see Phobius details PF02625: XdhC_CoxI" amino acids 17 to 79 (63 residues), 86.8 bits, see alignment E=7.5e-29 PF13478: XdhC_C" amino acids 156 to 296 (141 residues), 114.3 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 81% identity to sjp:SJA_C1-07530)

Predicted SEED Role

"Carbon monoxide dehydrogenase F protein" in subsystem CO Dehydrogenase or Carbon monoxide dehydrogenase maturation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF611 Dehydrogenase molybdenum cofactor insertion protein, XdhC/CoxF family (Sphingobium sp. HT1-2)
MNDNGAVIRKAIEWRDAPMALATVVSTWGSAPRPRGSHMIVHQDGRLEGSISGGCVETDV
LQRAAEVIAGRPGHVAHYGVADGDAWEVGLPCGGEISVLVQPVGEGGFAPDLFDRIASES
ARGRALTLSTDLDSAITREGVIEGQFLNRYDPPRRLLIVGAVQIAQSLAALAQAIAVTPV
VIDPRGRFLTAERFPGIELDDRWPDAAIAARHPGESTAVVTLSHDIKIDDPALIAALAAP
TGYVAALGSRRSHAARLERLAAQGFGADDLARIDGPAGLDIGAIGASEIALSITAGMVAG
FNAKR