Protein Info for GFF6082 in Variovorax sp. SCN45

Annotation: MoxR-like ATPase in aerotolerance operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF20030: bpMoxR" amino acids 17 to 187 (171 residues), 59.3 bits, see alignment E=8.7e-20 PF07728: AAA_5" amino acids 47 to 175 (129 residues), 48.1 bits, see alignment E=3.7e-16 PF07726: AAA_3" amino acids 47 to 177 (131 residues), 216 bits, see alignment E=4.3e-68 PF00158: Sigma54_activat" amino acids 48 to 158 (111 residues), 24.2 bits, see alignment E=7.6e-09 PF17863: AAA_lid_2" amino acids 254 to 317 (64 residues), 59.1 bits, see alignment E=9e-20

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 95% identity to vap:Vapar_1243)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF6082 MoxR-like ATPase in aerotolerance operon (Variovorax sp. SCN45)
MSTETAAPTPAGTAELMEQILYEVKRVVVGQDRFLERVMVAMLAGGHLLVEGVPGLAKTL
TIKTLADTVRGQFKRIQFTPDLVPADLVGTRIYNQKTGEFSTSLGPVFANLLLADEINRA
PAKVQSALLEVMQERQVTIAGETHKVPRPFLVMATQNPIETEGTYPLPEAQVDRFMMKVM
VDYPSDEEEFVIVQRVIGPPVAATPVATTEQLAELQAEARRVYVDPSLIQYAVKLVSATR
TPEKHGLKDLRRFITFGASPRASISLTEGARALALLRGRSYALPEDMTALVPDVLRHRVT
LSYEGLSEGLTPDGLVDKIMRAVPAPPKPLEHEKLVA