Protein Info for GFF6069 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 297 to 314 (18 residues), see Phobius details PF00892: EamA" amino acids 25 to 160 (136 residues), 72.4 bits, see alignment E=2.3e-24 amino acids 178 to 314 (137 residues), 58.3 bits, see alignment E=5.5e-20

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_1350)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>GFF6069 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MNKTAATAGIPSRPSHDAARKGVATGLILATLGAIAFSGKAIIVKLAYRYGVDAVTLIML
RMLFALPLFAVMAWWAGRGKPPLTTRDWFGVVGLGFSGYYLASFLDFAGLAYISASFERL
ILYLNPTLVLFFGWLMYRRRPTRPQVLGMVVSYAGVLLVFGHELWSGAGGKGGGAAAWGA
FLVFLSAVSYAGYLVYSGEFVKRLGSLRLVGLATTVACVLCILQFVLTRPMSTAFALAPE
VIWLSVLNATLCTAVPVLMVMMAIERIGPATAAQTGMIGPLSTILMGVVILGEPFTPWIA
AGTVLVIAGIFVFTRKGR