Protein Info for GFF6063 in Variovorax sp. SCN45

Annotation: Sodium/bile acid symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF13593: SBF_like" amino acids 9 to 319 (311 residues), 337.9 bits, see alignment E=6.4e-105 PF01758: SBF" amino acids 41 to 221 (181 residues), 45.1 bits, see alignment E=9.4e-16

Best Hits

Swiss-Prot: 69% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 84% identity to vpe:Varpa_1360)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF6063 Sodium/bile acid symporter family (Variovorax sp. SCN45)
MARSRFLPDNFTLALVTVVTIASLLPASGRVAHFFEGLTTVAIGLLFFLHGAKLSREAIM
AGITHWRLHLLVFASTFVLFPVLGLALKPVLSPLVTPDLYIGVLFLCVLPATVQSAIAFT
AMARGNMPAAICSASASTLLGVFVTPVLVNLVVLPHNGGATSSFDSIGRILLQLMVPFLA
GHLLRPVIGKWVQKRAAVLKFVDQGSILLVVYTAFSAAVIEGLWKQIPMSALLGLLLVCA
VLLALALTLTTLIARKLGFDTADEITIVFCGSKKSLASGIPMAKVLFASHAVGAIVLPLM
LFHQMQLMVCAVLAQRYARRGQDAAPALKAAAQK